Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF346582_1.cds

[Submit comment/correction]

Sequence	AF346582_1.cds
Peptide	TKEKIYGPDAGTDYEDNQLRFSLLCQAALEVPRILDLNNNPHFSGPYGED VVLVCNDWHTGLLACYLKSNYQSNGIYRTA
Structure From Source	AF346582
Source Exons	1 143 269 365
Corresponding Protein	AF346582_1.protseq
Gene	WX-TlB
Gene Product	waxy
Remark	CDS note: granule-bound starch synthase DB_xref: GI:19070398 Feature: CDS: protein_id = 'AAL83843.1'; Gene: WX-TlB
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.