Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Z99941_1.cds

[Submit comment/correction]

Sequence	Z99941_1.cds
Peptide	KILFTSLCHTDVYFWEAKGQTPMFPRIFGHEAGGIVESVGEGVTDVAP
Structure From Source	Z99941
Source Exons	1 56 161 207 862 903
DB Remark	1.1.1.1
Corresponding Protein	Z99941_1.protseq
Gene Product	alcohol dehydrogenase 1
Remark	DB_xref: GI:4138080 [ Show all 9 ]
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.