Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Z99937_1.cds

[Submit comment/correction]

Sequence	Z99937_1.cds
Peptide	KILFTSLCHTDVYFWEAKGQTPMFPRIFGHEAGGIVESVGEGVTDVAP
Structure From Source	Z99937
Source Exons	1 56 161 207 859 900
DB Remark	1.1.1.1
Corresponding Protein	Z99937_1.protseq
Gene Product	alcohol dehydrogenase 1
Remark	DB_xref: GI:4138060 DB_xref: SPTREMBL:Q9ZNQ2 Feature: CDS: protein_id = 'CAB17063.1'; Gene: ADH1
Codon Start	3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.