Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: Z37115_1.cds

[Submit comment/correction]

Sequence	Z37115_1.cds
Peptide	MARSAATQLVLVAMVAAMLLVAADAAISCGQVSSALRPCISYASGNGGIL PPACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVS VPYAISASVDCSKIR
Structure From Source	Z37115
Source Exons	1 348
Corresponding Protein	Z37115_1.protseq
Gene Product	lipid transfer protein precursor
Remark	CDS note: 82% homologous to CDS of pKG2316 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.