Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X69937_1.cds

[Submit comment/correction]

Sequence	X69937_1.cds
Peptide	MASKSSITPLLLAAVLASVFAAATATGQYCYAGMGLPSNPLEGCREYVAQ QTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQHCRCEAVRYFIGRRSHP DWSVLKDLPGCPKEPQRDFAKVLVTPGQCNVLTVHNAPYCLGLDI
Structure From Source	X69937
Source Exons	1 438
Corresponding Protein	X69937_1.protseq
Gene Product	CMa, component of tetrameric alpha-amylase inhibitor
Remark	DB_xref: GI:439275 [ Show all 9 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.