Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X54484_3.cds

[Submit comment/correction]

Sequence	X54484_3.cds
Peptide	MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVY
Structure From Source	X54484
Source Exons	1 114
Corresponding Protein	X54484_3.protseq
Gene Product	ribosomal protein S12
Remark	DB_xref: GI:12337 [ Show all 7 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.