Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: X14107_2.cds

[Submit comment/correction]

Sequence	X14107_2.cds
Peptide	MATQTVEDSSKPRPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALF AIFLSIILEIYNSSILLDGILTN
Structure From Source	X14107
Source Exons	1 222
Corresponding Protein	X14107_2.protseq
Gene Product	10kD phosphoprotein
Remark	DB_xref: GI:11595 [ Show all 8 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.