Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AF011552_1.cds

[Submit comment/correction]

Sequence	AF011552_1.cds
Peptide	KGKLPKEARQKLLHWWELHSKSPYPSETEKMALGESTGLDQKQINNWFIN QRKRHCKP
Structure From Source	AF011552
Source Exons	1 78 199 293
Corresponding Protein	AF011552_1.protseq
Gene Product	homeobox protein
Remark	DB_xref: GI:2306987 Feature: CDS: protein_id = 'AAB65796.1'; Gene: Knotted-1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.