Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: A37987_1.cds

[Submit comment/correction]

Sequence	A37987_1.cds
Peptide	AVTTLLLMVNEATRFQTVSGFVAGLLHPKAVEKKSGKIGNEMKAQVNGWQ DLSAALLKTDVKPPPGKSPAKFTPIEKMGVRTAEQAAATLGILLFVEVPG GLTVAKALELFHASGGK
Structure From Source	A37987
Source Exons	1 354
Corresponding Protein	A37987_1.protseq
Gene Product	protein synthesis inhibitor
Remark	DB_xref: GI:2294644 Feature: CDS: partial; standard_name = 'PSI'; protein_id = 'CAA02315.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.