Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: NC_002762_22.cds

[Submit comment/correction]

Sequence	NC_002762_22.cds
Peptide	MPRSRVNGNFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSEGN YAEALQNYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALE RNPFLPQAFNNMAVICHYRGEQAILQGDSEIAEAWFDQAAEYWKQAIALT PGNYIEAQNWLKITKRFEFE
Structure From Source	NC_002762
Source Exons	1 159 891 1120 1877 2000
Corresponding Protein	NC_002762_22.protseq
Gene	ycf3
Gene Product	photosystem I P700 apoprotein A2 photosystem I P700 apoprotein A1 photosystem I assembly protein Ycf3
Remark	DB_xref: GI:14017572 [ Show all 11 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.