Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB297599_1.cds

[Submit comment/correction]

Sequence	AB297599_1.cds
Peptide	GTGKKKFEKLLKSMEEKFPGKVRAVVRFNAPLAHQMMAGADLLAVTSRFE PCGLIQLQGMRYGTPCVCASTGGLVDTIVEGKTGFHMGRLSVDCNVVEPA DVKKVA
Structure From Source	AB297599
Source Exons	1 192 275 361 459 496
Corresponding Protein	AB297599_1.protseq
Gene	waxy
Gene Product	granule-bound starch synthase
Remark	CDS note: exon9, exon10 and partial exon11 for Waxy DB_xref: GI:161339149 Feature: CDS: protein_id = 'BAF93995.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.