GrainGenes Sequence Report: AB193608_1.cds
Sequence
AB193608_1.cds
Peptide
MTVDRKHAEAAAAAPFEIPALQPGRKKRPRRSRDGPNSVSETIRRWKEVN
QQLEHDPQGAKRARKPPAKGSKKGCMLGKGGPENTQCGFRGVRQRTWGKW
VAEIREPNRVSRLWLGTFPTAEDAARAYDEAARAMYGALARTNFPVHPAQ
APAVAVPAAIEGVVRGASASCESTTTSTNHSDVASSLPRQAQAPEIYSQP
DALESTESVVLESVEHYSHQDTVPDAGSSISRSTSEEDVFEPLEPISSLP
DGEADGFDIEELLRLMEADPIEVELVTGGSWNGGANTGVEMGQQEPLYLD
GLDQGMLEGMLQSDYPYPMWISEDRAMHNSAFHDAEMSEFFEGL
Structure From Source
AB193608
Source Exons
1 1035
Corresponding Protein
AB193608_1.protseq
Gene
Wdreb2
Gene Product
EREBP/AP2 type transcription factor
Remark
DB_xref: GI:62898547 Feature: CDS: protein_id = 'BAD97369.1' Feature: CDS: protein_id = 'BAD97369.1'; Gene: Wdreb2
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: AB193608_1.cds
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
