GrainGenes Sequence Report: AB042240_72.cds
Sequence
AB042240_72.cds
Peptide
MAVPKKRTSMSKKRIRKNIWKKKTYFSIVQSYSLVKSRSFSSGNEHPKPK
GFSGQQTNNKIFE
Structure From Source
AB042240
Source Exons
1 192
Corresponding Protein
AB042240_72.protseq
Gene
rpl32
Gene Product
ribosomal protein L32
Remark
DB_xref: GI:13928254 Feature: CDS: transl_table = 11; protein_id = 'BAB47083.1'; Gene: rpl32
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: AB042240_72.cds
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
