Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AB042240_1.cds

[Submit comment/correction]

Sequence	AB042240_1.cds
Peptide	MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVYKKPNSALRKVAR VRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDA VAVKNRQQGRSRYGVKKPKK
Structure From Source	AB042240
Source Exons	1 28 569 789 -20957 -20844
Corresponding Protein	AB042240_1.protseq
Gene Product	ribosomal protein S12
Remark	DB_xref: GI:13928250 Feature: CDS: transl_table = 11; protein_id = 'BAB47079.1'; ; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.