GrainGenes Sequence Report: EU326024_1.cds
Sequence
EU326024_1.cds
Peptide
FLPLILVCASGGARMQEGSVSLMQMAKISSALYDYQSNKKLFYVAILTSP
TTGGVTASFGMLGDIIIAEPNAYIAFAGKRVIEQTLNTTVPEGSQVAEYL
FDKGLFDLIVPRNP
Structure From Source
EU326024
Source Exons
1 344
Corresponding Protein
EU326024_1.protseq
Gene
accD
Gene Product
AccD
Remark
DB_xref: GI:164453500 Feature: CDS: transl_table = 11; protein_id = 'ABY57509.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: EU326024_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
