Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AY304482_1.cds

[Submit comment/correction]

Sequence	AY304482_1.cds
Peptide	MPGLTIGDTVPNLELDSTHGKIRIHDYVGNGYVILFSHPGDFTPVCTTEL AAMANYAKEFEKRGVKLLGISCDDVQSHKEWTKDIEAYKPGSKVTYPIMA DPDRSAIKQLNMVDPDEKDAEGQLPSRTLHIVGPDKKVKLSFLYPSCTGR NMDEVVRAVDSLLTAAKHKVATPANWNPGECVVIAPGVSDDEAKKMFPQG FETADLPSKKGYLRFTKV
Structure From Source	AY304482
Source Exons	1 657
Corresponding Protein	AY304482_1.protseq
Gene Product	1-Cys-peroxiredoxine
Remark	CDS note: peroxidase; important in detoxification of reactive oxygen species (ROS), which damage nucleic acids, proteins and lipids; conserved catalytic cysteine residue of this peroxiredoxin family subgroup localized in N-terminus of protein; simimlar to Triticum turgidum PER1 DB_xref: GI:34539782 Feature: CDS: function = 'catalyzes reduction of various hydroperoxides'; protein_id = 'AAQ74769.1'; Gene: PER1
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.