GrainGenes Sequence Report: AY131234_1.cds
Sequence
AY131234_1.cds
Peptide
CRCLEILCAILLPPLGVCLRHGCCSMEFWISVLLTILGYLPGVLYAAYVI
CSVDPDRVRRRDDDYIYVA
Structure From Source
AY131234
Source Exons
1 207
Corresponding Protein
AY131234_1.protseq
Gene Product
putative low temperature and salt responsive protein
Remark
DB_xref: GI:22900943 Feature: CDS: protein_id = 'AAN06944.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: AY131234_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
