Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AAHF01000014_118.cds

[Submit comment/correction]

Sequence	AAHF01000014_118.cds
Peptide	MVSTAITRPASLVVRFMQWSSAVIVMGITSYFINKWPHTQHTIYWEVIST MSVVFFLPAFLSPFMPTRLSRFVLPIDVIFSYLWLTAFIFAAQDYNWHNC AVNAPPGASCALKKANESFIFLAL
Structure From Source	AAHF01000014
Source Exons	1 127 179 282 335 478
Corresponding Protein	AAHF01000014_118.protseq
Gene Product	hypothetical protein
Remark	DB_xref: GI:66844662 Feature: CDS: locus_tag = 'Afu8g01690'; protein_id = 'EAL84999.1'; On complementary strand.
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.