Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AAHF01000014_13.cds

[Submit comment/correction]

Sequence	AAHF01000014_13.cds
Peptide	MSSAIPTSSVNPVKGMRKNGKNWHDSKKPFRPTSGLTSYEKRLEARKRQE AVKEHERELREEKEAERKAQIQKIKDRRAAKEEKERYEKMAEKMHRKRVE RLKRREKRNKLLHS
Structure From Source	AAHF01000014
Source Exons	1 58 195 340 400 540
Corresponding Protein	AAHF01000014_13.protseq
Gene Product	nucleolar protein CgrA
Remark	CDS note: go_component: nucleolus [goid 0005730]; go_process: ribosome biogenesis [goid 0007046] DB_xref: GI:66844557 Feature: CDS: locus_tag = 'Afu8g02750'; protein_id = 'EAL84894.1'
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.