Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: EF108864_1.cds

[Submit comment/correction]

Sequence	EF108864_1.cds
Peptide	DEAVKMVLDAVEQVGGIYLVTADHGNAEDMVKRNKAGQPMLDKSGSIQIL TSHTLQPVPVAIGGPGLHPGVRFRSDIQTPGLANVAATVMNLHGFQAPAD YETTLIEVVDK
Structure From Source	EF108864
Source Exons	1 15 163 318 412 576
Corresponding Protein	EF108864_1.protseq
Gene	Bp5A
Gene Product	Bp5A protein
Remark	CDS note: involved in ATP biosynthesis; involved in conversion of phosphoglycerate C2 to phosphoglycerate C3 DB_xref: GI:129919928 Feature: CDS: protein_id = 'ABO31539.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.