GrainGenes Sequence Report: EF104509_1.cds
Sequence
EF104509_1.cds
Peptide
KFGAVFASIPAPIFAALYCVFFAYVGSAGLGFLQFCNLNSFRTKFILGFS
VFMGFSVPQYFNEYTSVAGFGPVHTRARWFNDMVNVLFSSKAFVGGIVAY
VLDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSEEFYSLPFNLNKFFPS
V
Structure From Source
EF104509
Source Exons
1 78 249 409 488 706
Corresponding Protein
EF104509_1.protseq
Gene
AlperA
Gene Product
xanthine/uracil/vitamin C permease
Remark
DB_xref: GI:129282189 Feature: CDS: protein_id = 'ABO30086.1';
Codon Start
3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: EF104509_1.cds
|
| |||||||
|
| |||||||
|
| |||||||
|
| |||||||
|
| |||||||
|
| |||||||
|
| |||||||
|
| |||||||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
