Query (optional)   in Class  

GrainGenes Sequence Report: EF104415_1.cds

[Submit comment/correction]

Sequence
EF104415_1.cds
Peptide
KFGAVFASIPAPIFAALYCVFFAYVGSAGLGFLQFCNLNSFRTKFILGFS
VFMGFSV
Structure From Source
EF104415
Source Exons
178
249342
Corresponding Protein
EF104415_1.protseq
Gene
AlperA
Gene Product
xanthine/uracil/vitamin C permease
Remark
DB_xref: GI:129282001
Feature: CDS: protein_id = 'ABO29992.1';
Codon Start
3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.