GrainGenes Sequence Report: EF104346_1.cds
Sequence
EF104346_1.cds
Peptide
RKMYALTWALQYINLFMINTGFIILAGQALKAIYVLFRDDGLLKLPYCIA
LSGFVCALFAFGIPYLSALRIWLGFSTVFSLIYIVIAFVLSLRD
Structure From Source
EF104346
Source Exons
1 95 293 482
Corresponding Protein
EF104346_1.protseq
Gene
AapA
Gene Product
amino acid permease
Remark
DB_xref: GI:129281862 Feature: CDS: protein_id = 'ABO29923.1';
Codon Start
3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: EF104346_1.cds
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
