GrainGenes Sequence Report: DQ863128_1.cds
Sequence
DQ863128_1.cds
Peptide
LLLLRSCCMDGEWSDGAASGGEQKASGDGVSADCNSPGSLSPPAVPSTSG
RRRSLQKRVVTVPLADLNVPRPKGVGEGNTPTDSWAWRKYGQKPIKGSPF
PRAYYRCSSSKGCP
Structure From Source
DQ863128
Source Exons
1 342
Corresponding Protein
DQ863128_1.protseq
Gene
WRKY45
Gene Product
WRKY transcription factor 45
Remark
DB_xref: GI:112145400 Feature: CDS: protein_id = 'ABI13410.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ863128_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
