GrainGenes Sequence Report: DQ863124_1.cds
Sequence
DQ863124_1.cds
Peptide
ARGDDGINWRKYGQKAVKGGKCPRSYYKCTLNCPVRKNVEHSADGRIIKI
VYRGQHCHEPPSKRFKDCGDLLNELDELNDAEEPSTRSLLGCQGYYGKPK
PITPNGTMVDGLLPTKEEGDEQLSSLSDIREDDGEIRTVDGDVGDADANE
RNAPGQKIIVSTTSDVDLLDDGYRWRKYGQKVVRGNPHPRSYYKCTYQGC
DVKKHVERS
Structure From Source
DQ863124
Source Exons
1 627
Corresponding Protein
DQ863124_1.protseq
Gene
WRKY41
Gene Product
WRKY transcription factor 41
Remark
DB_xref: GI:112145363 Feature: CDS: protein_id = 'ABI13406.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ863124_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
