GrainGenes Sequence Report: DQ630442_1.cds
Sequence
DQ630442_1.cds
Peptide
MKTFLIFALLAIAATSAIAQMETSRVPGLEKPWQQQPLPPQQQPPFSQQQ
QPSSQQPPFPQQHQQFPQQQIPVVQPSVLQQLNPCKVFLQQQCSHVAMSQ
RLARSQMWQQSSCHVMQQQCCQQLPQIPEQSRSEAIRAIVYSIILQEQQQ
GFVQPQQQQPQQSGQGVSQHQQQSQQQQQLGQCSFQQPQQLQQLGQQPQQ
QQIPQGIFLQPHQISQLEVMTSIALRTLPTMCGVNVPLYSSTTIMPFSIG
TGVGAY
Structure From Source
DQ630442
Source Exons
1 771
Corresponding Protein
DQ630442_1.protseq
Gene
XYGluB3
Gene Product
LMWGS2
Remark
CDS note: LMW2 DB_xref: GI:108885289 Feature: CDS: protein_id = 'ABG23189.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ630442_1.cds
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
| ||||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
