GrainGenes Sequence Report: DQ512351_1.cds
Sequence
DQ512351_1.cds
Peptide
MGRGKVELKRIDNKSSRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFST
RGRLFEFSTSSCMYKTLERYRSCNFNSEATSTPESEDYQEYLKLKTRVDF
LQTTQRNLLGEDLGPLNMKELEQLENHIEMSLKHIRATKSQQSFDQLFEL
KRKEQQLQDVNKDLRKKIQETSAESVLQMFCQDVDVGPSGSSGHANQANQ
QQHFHPDCDPSLRMIMLTWTT
Structure From Source
DQ512351
Source Exons
1 666
Corresponding Protein
DQ512351_1.protseq
Gene
AGL34
Gene Product
MADS-box transcription factor TaAGL34
Remark
DB_xref: GI:95981911 Feature: CDS: protein_id = 'ABF57935.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ512351_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
