GrainGenes Sequence Report: DQ512334_1.cds
Sequence
DQ512334_1.cds
Peptide
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSN
RGKLYEFCSTQSMTKTLDKYQKCSYAGPETTVQNRENEQLKNSRNEYLKL
KARVDNLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHIRTTRTQHMV
DQLTELQRREQMFSEANKCLRIKLEESNQVHGQQLWEHNNNVLSYERQPE
VQPPMHGGNGFFHPLDAAGEPTLHIGYPPEPLNSSCMTTFMPPWLP
Structure From Source
DQ512334
Source Exons
1 741
Corresponding Protein
DQ512334_1.protseq
Gene
AGL16
Gene Product
MADS-box transcription factor TaAGL16
Remark
DB_xref: GI:95981866 Feature: CDS: protein_id = 'ABF57918.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ512334_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
