GrainGenes Sequence Report: DQ364891_1.cds
Sequence
DQ364891_1.cds
Peptide
RLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLENVRFYKEEEKNDP
EFAKKLASLADLFVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDY
LDGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYK
AQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDAN
SQTVP
Structure From Source
DQ364891
Source Exons
1 29 132 392 552 869 996 1003
Corresponding Protein
DQ364891_1.protseq
Gene
pkk1
Gene Product
3-phosphoglycerate kinase
Remark
DB_xref: GI:88657211 Feature: CDS: protein_id = 'ABD47391.1';
Codon Start
3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ364891_1.cds
|
| |||||||||
|
| |||||||||
|
| |||||||||
|
| |||||||||
|
| |||||||||
|
| |||||||||
|
| |||||||||
|
| |||||||||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
