GrainGenes Sequence Report: DQ343301_1.cds
Sequence
DQ343301_1.cds
Peptide
MDRYEVVRDIGSGNFGVAKLVRDVRTKEHFAVKFIERGHKFRVTSNGSER
VVGRS
Structure From Source
DQ343301
Source Exons
1 168
Corresponding Protein
DQ343301_1.protseq
Gene
W55b
Gene Product
W55b
Remark
DB_xref: GI:87312442 Feature: CDS: protein_id = 'ABD37623.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ343301_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
