Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: DQ290658_1.cds

[Submit comment/correction]

Sequence	DQ290658_1.cds
Peptide	RPKGVTPKFSLAPLVPRLSELLGIEVKKAEDVIGPEVEKLVADLANGAVL LLENVRFYKEEEKNDPEFAKKLASLADLFVNDAFGTAHRAHASTEGVTKF LKPSVAGFLLQKELDYLDGAVSNPKRPFAAIVGGSKVSSKIGVIESL
Structure From Source	DQ290658
Source Exons	1 76 173 433 605 708
Corresponding Protein	DQ290658_1.protseq
Gene	pgk1
Gene Product	3-phosphoglycerate kinase
Remark	DB_xref: GI:83268204 Feature: CDS: protein_id = 'ABB99614.1';
Codon Start	2

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.