GrainGenes Sequence Report: DQ158090_1.cds
Sequence
DQ158090_1.cds
Peptide
HGQFRFRRPWSQYQKLGTLCHQCASSMEALASCVITTTKTQYPAAANPEL
SFKVRKTCREMSTHSAKVLRGLEMAIRTMTVPYLANNTVVVAMKVAERLR
SELEENAALLQVMHMAVTAMLLADLVDRVKEITECVDVLARLAHFKNPED
AKYAIVGALTRGIDDPLPDVVIL
Structure From Source
DQ158090
Source Exons
1 125 234 632
Corresponding Protein
DQ158090_1.protseq
Gene
ALMT1-3
Gene Product
aluminum-activated malate transporter
Remark
DB_xref: GI:77166850 Feature: CDS: protein_id = 'ABA62401.1';
Codon Start
3

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: DQ158090_1.cds
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
| |||||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
