Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: D10057_1.cds

[Submit comment/correction]

Sequence	D10057_1.cds
Peptide	MHAYMQVVTNGYLKAVQHRAATNFAEPRLSVASFIVPADDCVVGPAEEFV SEDNPPRYRTLTVGEFKRKHNVVNLDSSINQIININNNEKGI
Structure From Source	D10057
Source Exons	1 279
Corresponding Protein	D10057_1.protseq
Remark	CDS note: ORF mugineic acid-family; phytosiderophore [ Show all 6 ]
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.