GrainGenes Sequence Report: AM502867_1.cds
Sequence
AM502867_1.cds
Peptide
MGRGKVEMRRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSG
RGRLFEFSSSSCMYRTLERYRTCNSNSQEATPPLENEINYQEYLKLKTRV
EFLQSSQRNILGEDLGPLSMKELDQIENQIDASLKHIRSKKNQVLLDQLF
ELKSKEQELQDENKDLRKKLRDTTSSCGENAVHMSWQDGGQSSSRVLQHP
EHDTSMQIGYPQAYMDQLNSRDHVASERPGGGSSAGWI
Structure From Source
AM502867
Source Exons
1 717
Corresponding Protein
AM502867_1.protseq
Gene
WM5A
Gene Product
MIKC-type MADS-box transcription factor WM5A
Remark
DB_xref: GI:161158774 Feature: CDS: protein_id = 'CAM59045.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: AM502867_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
