GrainGenes Sequence Report: AM502863_1.cds
Sequence
AM502863_1.cds
Peptide
MQILNEQLAAPSTGLMVKESASPGSGSGSAGGAAEKMGRGRIEIKRIENT
TNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSGRGRLYEYSNNSVKA
TIERYKKATSDTSSAGTVAEINAQHYRQESAKLKQQITTLQNSNRTLIGD
TMATMSHRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNNN
FFLREKVAETERGQQQTLNMMGAASTSNEYEQNMIHCDPRTFLQFNFMQQ
QPQYYSQQEDRKSFNSVGR
Structure From Source
AM502863
Source Exons
1 810
Corresponding Protein
AM502863_1.protseq
Gene
WM2
Gene Product
MIKC-type MADS-box transcription factor WM2
Remark
DB_xref: GI:161158766 Feature: CDS: protein_id = 'CAM59041.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Sequence Report: AM502863_1.cds
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
| |||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
