Query (optional)   in Class  All Allele Author Colleague Collection Assembly Gene Gene Class Gene Product Germplasm Image Journal Keyword Library Locus Map Map Data Marker Pathology Polymorphism Probe Protein QTL Rearrangement Reference Sequence Species Trait Trait Study Two Point Data  

---

GrainGenes Sequence Report: AM491358_2.cds

[Submit comment/correction]

Sequence	AM491358_2.cds
Peptide	MEQAIAPPLPIRDYQYQTPSIPGSSDYAWRTFVFVTFGLLIAVGVA
Structure From Source	AM491358
Source Exons	1 138
Corresponding Protein	AM491358_2.protseq
Gene	v1
Gene Product	movement protein
Remark	DB_xref: GI:166787945 Feature: CDS: protein_id = 'CAM33008.1';
Codon Start	1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.