GrainGenes Protein Report: DQ158091_1.protseq
Protein
DQ158091_1.protseq
Peptide
HGQFRFRHPWSQYQKLGTLCRQCASSMEALASYVITTTKTQYPAAANPEL
SFKVRKTCREMSTHSAKVLRGLEMAIRTMTVPYLANNTVVVAMKVAERLR
SELEENAALLQVMHMAVTAMLLADLVDRVKEITECVDVLARLAHFKNPED
AKYAIVGALTRGIDDPLPDVVIL
From Database
GenBank
Corresponding DNA
DQ158091_1.cds

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.
GrainGenes Protein Report: DQ158091_1.protseq
|
| ||
|
| ||
|
| ||
|
|
GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture. | |||
